10 Best Eye Creams Available in India

The first signs of wrinkles and ageing show up around the eyes. With dull skin around your eyes, you tend to look older than you actually are. Simple method to keep your under eye skin firmer and look young is to moisturize area around your eyes. There are several eye creams that have proved to be very efficient. So, without any hesitation you may proceed to buy any of these top under eye creams. Here we are listing out few of the best eye creams available in India so that it will help you all who are searching for the best one for regular use.

Forest Essentials Intensive Eye Cream With Anise Review Price Photos (3)

Forest Essentials Intensive Eye Cream with Anise (Rs.2200)

Texture wise, this cream is not very thick or greasy. It is a very thin cream which gets absorbed into the skin easily. This eye cream hydrates under eye area, makes it smoother, fades the lines and also reduces the pigmentation to a lot of extent. It makes eyes look healthier, the skin around the eyes feels plumper and smoother. It is considered amongst best eye creams in India.

Read review here.

Innisfree Orchid Enriched Cream, Eye Cream, Massage Cream (3)

Innisfree Orchid Eye Cream (Rs 1500)

Innisfree Orchid Eye Cream is balmy in nature yet non-sticky. A tiny amount is sufficient for applying around both the eyes. This cream gets absorbed in no time leaving the skin butter smooth. It is best suited to combat dryness around eye area and works perfectly under makeup concealer.

Read more about the eye cream here.

Lotus Herbals YouthRx Anti-Ageing Range Review Price Photos (21)

Lotus Herbals YouthRx Anti-Ageing Eye Contour Creme (Rs.695)

This under eye crème is well suited for treating fines line under the eye area that appears due to stress and strain. The product comes in a tube package which has a small pointed nozzle opening. The natural proteins and Gineplex youth compound shows visible results in few days of regular using.

Read review here.

Vichy Aqualia Thermal Spa Eye roll on & Lip Balm (1)

Vichy Aqualia Thermal Eye Roll On (Rs.1350)

This gel eye roll on is made for skin that is dull and tires. It helps in moisturizing the under eye area very well and reduces puffiness. Though it might be very slow in reducing darkness around eye, it brings youthfulness by highly moisturizing the skin and reducing fine lines. The ball in the package of Vichy Aqualia Thermal Eye Roll On feels cold and relaxing when applied. This way it helps to remove the dull tired look around the eyes.

Read review here.

L'Oreal White Perfect Magic White Double Whitening Day & Eye Cream review (1)

L’Oreal White Perfect Magic White Double Whitening Eye Cream (Rs.599)

This Eye cream is slightly pale in color and has gold flecks/ fine shimmers which catch and reflect light, reducing appearance of shadows. The texture of cream is quite smooth, almost silicon like. It quickly sinks into the skin without leaving any oily residue. The long sleek package is easy to travel with and will sneak into any corner of your bag.

Read more about this eye cream here.

neutrogenarapidwrinklerepaireyecream282291

Neutrogena Rapid Wrinkle Repair Eye Cream (Rs.549)

It is very light cream, easy to spread and does moisturize the eye area. It provides a good base for makeup concealer. It gets absorbed into skin quickly. With prolonged and regular usage one can definitely notice reduced fine lines around the eye area. This eye cream is a decent one and provides good moisturizing to the under eye skin.

Read complete review here.

Kaya Brightening & Firming eye Serum review (2)

Kaya Brightening & Firming Eye Serum (Rs.990)

Eye serums are preferred by many over eye creams as serums have a better texture and are quickly absorbed. Kaya Brightening & Firming Eye Serum has a formula that is slightly thicker and clear which spreads easily and absorbs quickly. It does not leave any stickiness or stretchy feel behind on the skin. It is very hydrating and makes under-eye area very smooth

Read review here.

Sebamed Q10 Lifting eye cream review (2)

Sebamed Q10 Lifting Eye Cream (Rs.800)

Sebamed Q10 Lifting Eye Cream has a gel-cream like consistency. It spreads and absorbs in to the skin quickly. It doesn’t leave much greasiness behind. This eye cream is formulated to increase elasticity of the under eye area and reducing appearance of fine lines. this can be the best eye creams if you are looking for moisturizing creams.

Read review here

 

Garnier White Complete Eye Roll On (Rs.189)

This is one of the most easily available and best affordable products when it comes to eye care. It is usually the first purchase for people who begin to worry about the appearance of fine lines, wrinkles, puffiness and tiredness around the eye area. The texture is liquidy and is easy to rub around and massage. The roll-on feels very cooling when applied under the eye. It reduces puffiness to a great extent.

Read review here.

Lotus Herbals Nutraeye Rejuvenating and Correcting Eye gel (Rs.275)

This eye gel from Lotus Herbals contains soya peptide and hydrolyzed wheat protein which diminishes fine lines, crow’s feet and dark circles. Regular usage has proven to show noticeable difference.

 

Hope you all find this list of best eye creams available in India useful. Do share your favorite ones in the comments below.

*Written By Chand

Best Eye Creams Available in India

  • Share on:
  • Facebook
  • Twitter
  • Pinterest
  • Google +

1 Comment

  • April 17, 2016

    Sangeeta G

    I’ve been looking to change my eye cream. I have used the FE one, it is definitely hydrating but it doesn’t do much for my dark circles.
    Sangeeta G recently posted…TRESemme Ionic Strength Conditioner | Review